PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c6_23360V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 1301aa    MW: 141602 Da    PI: 6.6173
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c6_23360V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-16527573148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g WT+eEd  lv++v+++G  +W++Ia  +  gR +kqc++rw+++l
  Pp3c6_23360V3.2.p 527 KGQWTPEEDRYLVELVERHGQQRWSLIATQLT-GRIGKQCRERWHNHL 573
                        799****************************9.*************97 PP

2Myb_DNA-binding54.42.9e-17579621145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        r+ W teE+e lv a+++lG++ W+ Ia++++ gRt++ +k++w+
  Pp3c6_23360V3.2.p 579 RDGWNTEEEEALVSAHNKLGNR-WADIAKMIP-GRTENAIKNHWN 621
                        567*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.608522577IPR017930Myb domain
SuperFamilySSF466891.09E-29524620IPR009057Homeodomain-like
SMARTSM007175.8E-16526575IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-27528579IPR009057Homeodomain-like
CDDcd001676.10E-14530573No hitNo description
PfamPF139213.1E-18530590No hitNo description
PROSITE profilePS5129419.42578628IPR017930Myb domain
SMARTSM007178.7E-16578626IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-20580627IPR009057Homeodomain-like
CDDcd001677.14E-12582621No hitNo description
Gene3DG3DSA:3.90.1170.405.2E-911661284IPR003448Molybdopterin biosynthesis MoaE
PfamPF023919.4E-911711284IPR003448Molybdopterin biosynthesis MoaE
SuperFamilySSF546901.06E-612081287IPR003448Molybdopterin biosynthesis MoaE
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006777Biological ProcessMo-molybdopterin cofactor biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1301 aa     Download sequence    Send to blast
MQLSVGDTKA SGSSTNVVAA TALGGSSKVA ALNNLPSTGS SLQNQSLNRL QHPSLGDGAP  60
TTRQQHDETT SNFPTFHEMG STAVNVSQQR QQASSYTLQS HEQHENTSGK GLMYNISDKT  120
SPGWRGRRTR EWSGDFQERS SQVTSENWAS PRSADGDEPT SLHFQDQWSN RKDLHLSAAN  180
QSCAPATLCS KRARVSKLLC HPRQDSGCLT TSPPTSPSQD ESATNSSNMW ESLFQRSHIM  240
QSSKPGAFAT GKQTEAGSTS TEGHRSIQLD ATNVQMDLGD ESMVAKIQAG EARNDLPASM  300
TTCSEEHLKR FQEAQRNIEL QQTNSGTIAG GGIRFESSPN NLLSDVITDT LRSRELPNQQ  360
IGSSSGYLGS TTYSAIDGWP QEGGSVTDYL LLTSAVHKAN LLDLQIQENQ RNLKQGILNC  420
CSDEYMSGSR PTDTVDYQTG LRMGSNGVSL EENGSPFCYS SLSMLPGHEF SVTNDFFMDS  480
RCNPGEQLTA RAAYEKTRNE QRGDCLPSKR VFKRSSKGGP RRPHIIKGQW TPEEDRYLVE  540
LVERHGQQRW SLIATQLTGR IGKQCRERWH NHLRPDIKRD GWNTEEEEAL VSAHNKLGNR  600
WADIAKMIPG RTENAIKNHW NATMRRKDLR RKHRRVADGS SDGLEVVPRC TILRDYQQKV  660
VAQGGGRKGR VFKSLPTVDD VDRFNKGNPD DTHSGTPESD SPQLTCGSPP GWTSNEIEKL  720
TLPARIVEMN STPEPDHTIM NNKMGRKDLQ EEVEGTRAST QYVNPLAHGN LISLVQSVGY  780
GASSVSSANP LQSRVSVWGQ GVGSYSRPPV TFWGGGQWAE GGSEVLFAEP AATGKAEDDD  840
AAIWVSQNNV PDYGSTSRFS DAATSDAVPV YQSSELRDLK ATDHITASQL GTLDQIVNDS  900
SRNSNNHPHL LPYSLERGSA SSQSKGMLQQ GRNKFSNLDL STQAYSSLDG SARPLHGHSH  960
FQATDELEQQ LESTSGAAGS VASLERKGIL TTGDNELAQA DRIGNNTREN PRALSTNPDI  1020
ILAAASAAAS DHCRYHPNAN PLAIVEPSVK RTVTIPNHQL SVNSFENANA NHDPRLSAYF  1080
GNPCHDTFNP HRQQVMNYVT GGPDHDISDV TSLLLSRGPM SSLADDITSV TSESTTFSNS  1140
SPLGRKYWDQ SPSHSSPSRG PGDLDLVELV AQPLDQAHYL RKVKHPACSE SLGVSTSVCT  1200
VPTVTENGRD IRGINFHSHT YHEAEAKLYD ICSKMRSQWQ LGCIALAHRV GVVGAGEVYA  1260
VVAVTSSDSD SSSHATRAAD FAVELLRSGG SALQHHNVLL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-445256272104C-Myb DNA-Binding Domain
1mse_C1e-445256272104C-Myb DNA-Binding Domain
1h89_C1e-4452362754158MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-4452362754158MYB PROTO-ONCOGENE PROTEIN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S103_56V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.11e-48myb domain protein 119